![PE/Elab Fluor® 594 Anti-Human CD31 Antibody [158-2B3] - E-AB-F1050P Size:100 Tests GRM1 Polyclonal Antibody](https://cdn.shopify.com/s/files/1/0305/9482/6376/products/logo_new_ba561337-a653-4fe5-8e75-b208a6aa9499.png?v=1710507881){kind=logo}
Pay in 4 interest-free payments of $35.00 Learn more
Ships within 48 hours · Estimated delivery Jul 28 - Aug 2
GRM1 Polyclonal Antibody
ENHGPEIKEHLNSLGEKLKTLWIQLRRCHRFLPCENKSKAVEQVKNDFNKLQDKGVYKAMNEFDIFINCIEAYVTLKMKN
E-AB-81480-100
Catalogue Numbers: E-EL-H0500-24T
Catalogue Numbers: AF0156-100
PE/Elab Fluor® 594 Anti-Human CD31 Antibody [158-2B3] - E-AB-F1050P Size:100 Tests GRM1 Polyclonal AntibodyPE Elab Fluor 594 Anti Human CD31 Antibody [158 2B3] Sizes: 20 Tests, 100 Tests, 100 Tests2 Catalogue Numbers: E AB F1050P 20, E AB F1050P 100, E AB F1050P 1002 Citations, Manuals and MSDS Available upon request. Abbreviation: CD31 Target Synonym: Platelet endothelial cell adhesion molecule, PECAM1, PECAM 1, EndoCAM, GPIIA', PECA1, CD31, Conjugation: PE Elab Fluor 594 Host: Mouse Species Reactivity: Human Application: FCM Usage: Each lot of this
US$ 950.00
US$ 325.00
US$ 375.00
US$ 950.00
US$ 425.00
US$ 375.00
US$ 175.00
US$ 425.00
US$ 375.00
US$ 450.00
US$ 525.00
US$ 425.00
US$ 325.00
US$ 1000.00
US$ 800.00